top of page

mmu_circAcadsb_858

Basic information of circular RNA
PanCircBase ID:

mmu_circAcadsb_858

mm39_Chr. Position ID:

chr7|131026200|131036091|+

Gene name:

Acadsb

Transcript:

ENSMUST00000015829.15

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

2,3,4,5,6,7

Exon/intron offsets:

0,1303,3957,5475,7465,9798

Genomic length:

9891

Exon/intron sizes in nt:

160,101,207,171,126,93

Flanking exon/introns:

chr7:131012516-131026200|chr7:131036091-131039130

Splice length:

858

Other database IDs:

circAtlas: mmu-Acadsb_0002

circAtlas: hsa-ACADSB_0005, CIRCpedia: HSA_CIRCpedia_367955

Human Ortholog IDs:
Mature spliced Sequence:

CTGAGAAGACGCTTCCCAACCTGCTTGTCTCCTTGGAAGATTCCTCCTCGTGTCCTCAAATCCTCACAACCGGAAGCTCTAGTCAGTCTGACAAACAATGCAGTAGCCTTTGCACCTCTGCAGACACTTACTGATGAGGAAATTATGATGAAGCAGACAGTCAAAAAATTTGCACAGGAGCACGTTGCTCCTCTGGTTTCCTCTATGGATGAGAACTCAAAAATGGAGAAATCGGTGATCCAGGGATTGTTCCAGCAAGGGCTGATGGGCATTGAAGTTGAAGCACAATATGGAGGGACAGAAGCTTCCTTTTTCTGCTCTGTCCTAGTGATAGAGGAACTAGCTAAGGTGGATGCTTCGGTGGCTCTCCTGTGTGACATCCAGAACACAATAATTAACAACCTGTTTAGAAAACACGCTTCAGAAGAACAGAAGGCCACCTATTTGCCAAAGCTGGTTACAGAAAAATTAGGGAGCTTTTGCCTCTCTGAAGCTGGAGCCGGTAGCGACTCTTTCGCTATGAAAACAAGAGCTGATAAAAGTGGAAATTACTACGTCCTCAATGGGTCGAAGATGTGGATCAGCCATGCCGAGCATGCAGAGCTCTTCCTGGTCTTCGCCAATGTGGACCCCAGCTCTGGCTACAGAGGCATCACCTGCTTCTTAGTAGACCGAGATACAGAAGGTTTCCAGATAGGGAAACGAGAAAATAAAATGGGCATCAGAGCTTCATCCACCTGTCAGTTAACATTTGAAAATGTTAAGGTTCCAGAGACTAATATTTTGGGGAAAATTGGGCATGGTTATAAGTATGCCATAGGAAGTCTTAATGAAGGTAGAATCGGAATTGCTGCACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGGGGAAAATTGGGCATGGT

60.18

GAGCTTCCGGTTGTGAGGAT

59.75

153

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGGGGAAAATTGGGCATGGT

60.18

AGCTTCCGGTTGTGAGGATT

59.31

152

PCR template sequence:

TGTTAAGGTTCCAGAGACTAATATTTTGGGGAAAATTGGGCATGGTTATAAGTATGCCATAGGAAGTCTTAATGAAGGTAGAATCGGAATTGCTGCACAGCTGAGAAGACGCTTCCCAACCTGCTTGTCTCCTTGGAAGATTCCTCCTCGTGTCCTCAAATCCTCACAACCGGAAGCTCTAGTCAGTCTGACAAACAATG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-322-5p(1), mmu-miR-33-5p(1), mmu-miR-19a-3p(1), mmu-miR-298-5p(1), mmu-miR-136-5p(1), mmu-miR-127-5p(1), mmu-miR-499-5p(1), mmu-miR-5101(1)

siRNAs for circular RNA silencing
Junction sequence

AATTGCTGCACAGCTGAGAAGACGCT

siRNA sets

GTCTTCTCAGCTGTGCAGC,TCTTCTCAGCTGTGCAGCA,AGCGTCTTCTCAGCTGTGC

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCACADSB_858_ORF_1

0.9608

0.159504613

0.99979652

1572

ORF sequence:

ATGATGAAGCAGACAGTCAAAAAATTTGCACAGGAGCACGTTGCTCCTCTGGTTTCCTCTATGGATGAGAACTCAAAAATGGAGAAATCGGTGATCCAGGGATTGTTCCAGCAAGGGCTGATGGGCATTGAAGTTGAAGCACAATATGGAGGGACAGAAGCTTCCTTTTTCTGCTCTGTCCTAGTGATAGAGGAACTAGCTAAGGTGGATGCTTCGGTGGCTCTCCTGTGTGACATCCAGAACACAATAATTAACAACCTGTTTAGAAAACACGCTTCAGAAGAACAGAAGGCCACCTATTTGCCAAAGCTGGTTACAGAAAAATTAGGGAGCTTTTGCCTCTCTGAAGCTGGAGCCGGTAGCGACTCTTTCGCTATGAAAACAAGAGCTGATAAAAGTGGAAATTACTACGTCCTCAATGGGTCGAAGATGTGGATCAGCCATGCCGAGCATGCAGAGCTCTTCCTGGTCTTCGCCAATGTGGACCCCAGCTCTGGCTACAGAGGCATCACCTGCTTCTTAGTAGACCGAGATACAGAAGGTTTCCAGATAGGGAAACGAGAAAATAAAATGGGCATCAGAGCTTCATCCACCTGTCAGTTAACATTTGAAAATGTTAAGGTTCCAGAGACTAATATTTTGGGGAAAATTGGGCATGGTTATAAGTATGCCATAGGAAGTCTTAATGAAGGTAGAATCGGAATTGCTGCACAGCTGAGAAGACGCTTCCCAACCTGCTTGTCTCCTTGGAAGATTCCTCCTCGTGTCCTCAAATCCTCACAACCGGAAGCTCTAGTCAGTCTGACAAACAATGCAGTAGCCTTTGCACCTCTGCAGACACTTACTGATGAGGAAATTATGATGAAGCAGACAGTCAAAAAATTTGCACAGGAGCACGTTGCTCCTCTGGTTTCCTCTATGGATGAGAACTCAAAAATGGAGAAATCGGTGATCCAGGGATTGTTCCAGCAAGGGCTGATGGGCATTGAAGTTGAAGCACAATATGGAGGGACAGAAGCTTCCTTTTTCTGCTCTGTCCTAGTGATAGAGGAACTAGCTAAGGTGGATGCTTCGGTGGCTCTCCTGTGTGACATCCAGAACACAATAATTAACAACCTGTTTAGAAAACACGCTTCAGAAGAACAGAAGGCCACCTATTTGCCAAAGCTGGTTACAGAAAAATTAGGGAGCTTTTGCCTCTCTGAAGCTGGAGCCGGTAGCGACTCTTTCGCTATGAAAACAAGAGCTGATAAAAGTGGAAATTACTACGTCCTCAATGGGTCGAAGATGTGGATCAGCCATGCCGAGCATGCAGAGCTCTTCCTGGTCTTCGCCAATGTGGACCCCAGCTCTGGCTACAGAGGCATCACCTGCTTCTTAGTAGACCGAGATACAGAAGGTTTCCAGATAGGGAAACGAGAAAATAAAATGGGCATCAGAGCTTCATCCACCTGTCAGTTAACATTTGAAAATGTTAAGGTTCCAGAGACTAATATTTTGGGGAAAATTGGGCATGGTTATAAGTATGCCATAGGAAGTCTTAATGAAGGTAGAATCGGAATTGCTGCACAG

Peptide sequence:

MMKQTVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFCSVLVIEELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAGAGSDSFAMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRDTEGFQIGKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQLRRRFPTCLSPWKIPPRVLKSSQPEALVSLTNNAVAFAPLQTLTDEEIMMKQTVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFCSVLVIEELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAGAGSDSFAMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRDTEGFQIGKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQ

IRESfinder result

IRESfinder score

0.6086352

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page