top of page

mmu_circAbhd2_344

Basic information of circular RNA
PanCircBase ID:

mmu_circAbhd2_344

mm39_Chr. Position ID:

chr7|78973216|78975349|+

Gene name:

Abhd2

Transcript:

ENSMUST00000037315.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

4,5

Exon/intron offsets:

0,1965

Genomic length:

2133

Exon/intron sizes in nt:

176,168

Flanking exon/introns:

chr7:78946955-78973216|chr7:78975349-78998007

Splice length:

344

Other database IDs:

circBase: mmu_circ_0014411, CIRCpedia: MMU_CIRCpedia_30104, circAtlas: mmu-Abhd2_0003

circBase: hsa_circ_0036687, circAtlas: hsa-ABHD2_0003, CIRCpedia: HSA_CIRCpedia_16028

Human Ortholog IDs:
Mature spliced Sequence:

ATACATTCCACCACTGATCTGGGGGAAAAGCGGACATATCCAGACAGCCTTGTATGGGAAGATGGGGAGGGTGAGGTCACCACACCCTTACGGGCACCGCAAGTTCATCACCATGTCGGATGGTGCCACTTCTACCTTCGACCTCTTCGAGCCCCTGGCTGAGCACTGTGTTGGAGATGACATCACCATGGTCATCTGTCCTGGAATTGCCAACCACAGCGAGAAGCAGTATATCCGAACCTTCGTTGACTATGCCCAGAAAAATGGCTACCGGTGCGCAGTGCTAAACCACCTGGGAGCCCTCCCCAACATTGAGCTGACCTCCCCACGAATGTTCACCTATG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GAAAAATGGCTACCGGTGCG

60.18

CGTAAGGGTGTGGTGACCTC

60.04

178

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GAGCCCTCCCCAACATTGAG

60.39

CGTAAGGGTGTGGTGACCTC

60.04

140

PCR template sequence:

GTTGACTATGCCCAGAAAAATGGCTACCGGTGCGCAGTGCTAAACCACCTGGGAGCCCTCCCCAACATTGAGCTGACCTCCCCACGAATGTTCACCTATGATACATTCCACCACTGATCTGGGGGAAAAGCGGACATATCCAGACAGCCTTGTATGGGAAGATGGGGAGGGTGAGGTCACCACACCCTTACGGGCACCGC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

4

Interacting miRNAs (#binding sites)

mmu-miR-29a-3p(1), mmu-miR-29c-3p(1), mmu-miR-182-5p(1), mmu-miR-190b-5p(1)

siRNAs for circular RNA silencing
Junction sequence

ATGTTCACCTATGATACATTCCACCA

siRNA sets

GAATGTATCATAGGTGAAC, GTGGAATGTATCATAGGTG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCABHD2_344_ORF_1

1.016

0.435959319

0.640498992

300

ORF sequence:

ATGGGGAGGGTGAGGTCACCACACCCTTACGGGCACCGCAAGTTCATCACCATGTCGGATGGTGCCACTTCTACCTTCGACCTCTTCGAGCCCCTGGCTGAGCACTGTGTTGGAGATGACATCACCATGGTCATCTGTCCTGGAATTGCCAACCACAGCGAGAAGCAGTATATCCGAACCTTCGTTGACTATGCCCAGAAAAATGGCTACCGGTGCGCAGTGCTAAACCACCTGGGAGCCCTCCCCAACATTGAGCTGACCTCCCCACGAATGTTCACCTATGATACATTCCACCACTGA

Peptide sequence:

MGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYDTFHH

IRESfinder result

IRESfinder score

0.30020525

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page