top of page

mmu_circAbcc4_852

Basic information of circular RNA
PanCircBase ID:

mmu_circAbcc4_852

mm39_Chr. Position ID:

chr14|118727910|118763815|-

Gene name:

Abcc4

Transcript:

ENSMUST00000036554.14

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

6

Exon/intron indexes:

30,29,28,27,26,25

Exon/intron offsets:

0,9467,10209,17094,25934,35713

Genomic length:

35905

Exon/intron sizes in nt:

13,51,06,17,39,01,56,100

Flanking exon/introns:

chr14:118721852-118727910|chr14:118763815-118765362

Splice length:

852

Other database IDs:

circAtlas: mmu-Abcc4_0002

circAtlas: hsa-ABCC4_0002, CIRCpedia: HSA_CIRCpedia_118901

Human Ortholog IDs:
Mature spliced Sequence:

ATGATTTCAGTGGAGAGAGTGATTGAGTACACGGACCTAGAGAAGGAGGCGCCTTGGGAGTGCAAGAAGCGCCCACCCCCAGGCTGGCCCCACGAGGGAGTCATCGTCTTCGACAATGTGAACTTCACCTACAGCTTAGATGGGCCTCTGGTTCTGAAGCACCTGACTGCGCTCATCAAGTCCAGGGAAAAGGTTGGAATTGTGGGCAGAACCGGAGCTGGGAAAAGCTCCCTCATCTCGGCCCTCTTCAGGCTGTCAGAACCCGAGGGGAAAATCTGGATCGATAAGATCTTGACAACCGAAATTGGGCTTCACGACTTAAGGAAGAAAATGTCAATCATACCACAGGAACCTGTTCTGTTCACTGGAACCATGAGGAAAAACCTGGACCCCTTCAATGAGCACACGGACGAGGAGCTGTGGAGGGCCTTGGAGGAGGTACAACTTAAAGAGGCCATTGAAGATCTTCCTGGAAAAATGGATACTGAATTAGCAGAATCTGGATCCAATTTCAGTGTTGGACAGAGACAGTTAGTGTGCCTTGCAAGGGCCATTCTAAAGAATAACCGAATACTGATCATTGATGAAGCAACTGCAAATGTGGACCCAAGAACGGATGAGTTAATACAACAGAAGATCCGGGAGAAGTTTGCCCAGTGCACAGTGCTCACCATTGCTCACAGACTGAACACCATCATTGACAGTGACAAGATAATGGTTTTGGATTCAGGAAGACTGAAAGAATATGATGAGCCGTATGTCTTGCTGCAGAATCCAGAGAGCCTCTTTTACAAGATGGTTCAGCAACTGGGCAAGGGCGAAGCCGCTGCCCTCACCGAAACAGCAAAACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GCCGTATGTCTTGCTGCAGA

60.74

GCCTCCTTCTCTAGGTCCGT

60.4

150

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGCTGCAGAATCCAGAGAGC

60.11

CGCCTCCTTCTCTAGGTCCG

61.45

140

PCR template sequence:

GCCGTATGTCTTGCTGCAGAATCCAGAGAGCCTCTTTTACAAGATGGTTCAGCAACTGGGCAAGGGCGAAGCCGCTGCCCTCACCGAAACAGCAAAACAGATGATTTCAGTGGAGAGAGTGATTGAGTACACGGACCTAGAGAAGGAGGCGCCTTGGGAGTGCAAGAAGCGCCCACCCCCAGGCTGGCCCCACGAGGGAG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-207(2), mmu-miR-124-3p(1), mmu-miR-23b-3p(1), mmu-miR-23a-3p(1), mmu-miR-673-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AACAGCAAAACAGATGATTTCAGTGG

siRNA sets

AAATCATCTGTTTTGCTGT,GAAATCATCTGTTTTGCTG,TGAAATCATCTGTTTTGCT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCABCC4_852_ORF_1

1.1603

0.334102043

0.999973476

1704

ORF sequence:

ATGATTTCAGTGGAGAGAGTGATTGAGTACACGGACCTAGAGAAGGAGGCGCCTTGGGAGTGCAAGAAGCGCCCACCCCCAGGCTGGCCCCACGAGGGAGTCATCGTCTTCGACAATGTGAACTTCACCTACAGCTTAGATGGGCCTCTGGTTCTGAAGCACCTGACTGCGCTCATCAAGTCCAGGGAAAAGGTTGGAATTGTGGGCAGAACCGGAGCTGGGAAAAGCTCCCTCATCTCGGCCCTCTTCAGGCTGTCAGAACCCGAGGGGAAAATCTGGATCGATAAGATCTTGACAACCGAAATTGGGCTTCACGACTTAAGGAAGAAAATGTCAATCATACCACAGGAACCTGTTCTGTTCACTGGAACCATGAGGAAAAACCTGGACCCCTTCAATGAGCACACGGACGAGGAGCTGTGGAGGGCCTTGGAGGAGGTACAACTTAAAGAGGCCATTGAAGATCTTCCTGGAAAAATGGATACTGAATTAGCAGAATCTGGATCCAATTTCAGTGTTGGACAGAGACAGTTAGTGTGCCTTGCAAGGGCCATTCTAAAGAATAACCGAATACTGATCATTGATGAAGCAACTGCAAATGTGGACCCAAGAACGGATGAGTTAATACAACAGAAGATCCGGGAGAAGTTTGCCCAGTGCACAGTGCTCACCATTGCTCACAGACTGAACACCATCATTGACAGTGACAAGATAATGGTTTTGGATTCAGGAAGACTGAAAGAATATGATGAGCCGTATGTCTTGCTGCAGAATCCAGAGAGCCTCTTTTACAAGATGGTTCAGCAACTGGGCAAGGGCGAAGCCGCTGCCCTCACCGAAACAGCAAAACAGATGATTTCAGTGGAGAGAGTGATTGAGTACACGGACCTAGAGAAGGAGGCGCCTTGGGAGTGCAAGAAGCGCCCACCCCCAGGCTGGCCCCACGAGGGAGTCATCGTCTTCGACAATGTGAACTTCACCTACAGCTTAGATGGGCCTCTGGTTCTGAAGCACCTGACTGCGCTCATCAAGTCCAGGGAAAAGGTTGGAATTGTGGGCAGAACCGGAGCTGGGAAAAGCTCCCTCATCTCGGCCCTCTTCAGGCTGTCAGAACCCGAGGGGAAAATCTGGATCGATAAGATCTTGACAACCGAAATTGGGCTTCACGACTTAAGGAAGAAAATGTCAATCATACCACAGGAACCTGTTCTGTTCACTGGAACCATGAGGAAAAACCTGGACCCCTTCAATGAGCACACGGACGAGGAGCTGTGGAGGGCCTTGGAGGAGGTACAACTTAAAGAGGCCATTGAAGATCTTCCTGGAAAAATGGATACTGAATTAGCAGAATCTGGATCCAATTTCAGTGTTGGACAGAGACAGTTAGTGTGCCTTGCAAGGGCCATTCTAAAGAATAACCGAATACTGATCATTGATGAAGCAACTGCAAATGTGGACCCAAGAACGGATGAGTTAATACAACAGAAGATCCGGGAGAAGTTTGCCCAGTGCACAGTGCTCACCATTGCTCACAGACTGAACACCATCATTGACAGTGACAAGATAATGGTTTTGGATTCAGGAAGACTGAAAGAATATGATGAGCCGTATGTCTTGCTGCAGAATCCAGAGAGCCTCTTTTACAAGATGGTTCAGCAACTGGGCAAGGGCGAAGCCGCTGCCCTCACCGAAACAGCAAAACAG

Peptide sequence:

MISVERVIEYTDLEKEAPWECKKRPPPGWPHEGVIVFDNVNFTYSLDGPLVLKHLTALIKSREKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWRALEEVQLKEAIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILKNNRILIIDEATANVDPRTDELIQQKIREKFAQCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNPESLFYKMVQQLGKGEAAALTETAKQMISVERVIEYTDLEKEAPWECKKRPPPGWPHEGVIVFDNVNFTYSLDGPLVLKHLTALIKSREKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWRALEEVQLKEAIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILKNNRILIIDEATANVDPRTDELIQQKIREKFAQCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNPESLFYKMVQQLGKGEAAALTETAKQ

IRESfinder result

IRESfinder score

0.543749551

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page