top of page

mmu_circAbca2_214

Basic information of circular RNA
PanCircBase ID:

mmu_circAbca2_214

mm39_Chr. Position ID:

chr2|25333240|25333454|+

Gene name:

Abca2

Transcript:

ENSMUST00000102919.4

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

1

Exon/intron indexes:

30

Exon/intron offsets:

0

Genomic length:

214

Exon/intron sizes in nt:

214

Flanking exon/introns:

chr2:25333166-25333240|chr2:25333454-25333540

Splice length:

214

Other database IDs:

circAtlas: hsa-ABCA2_0010, CIRCpedia: HSA_CIRCpedia_125731

Human Ortholog IDs:
Mature spliced Sequence:

AGACGTGGACGTCGGCGCCTTCTCTGCCACGCCTAGTGCATGAGCCAGTCCGCTGTACCTGCTCTGCACAGGGCACGGGGTTCTCATGCCCCAGCAGTGTGGGTGGACACCCACCCCAGATGAGAGTGGTCACAGGTGACATCCTGACTGACATCACTGGCCACAATGTTTCTGAGTACCTGCTCTTCACCTCTGACCGTTTCCGACTACACCG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GACTGACATCACTGGCCACA

59.96

CCTGTGCAGAGCAGGTACAG

60.39

141

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGACTGACATCACTGGCCAC

59.96

CCTGTGCAGAGCAGGTACAG

60.39

142

PCR template sequence:

CCCAGATGAGAGTGGTCACAGGTGACATCCTGACTGACATCACTGGCCACAATGTTTCTGAGTACCTGCTCTTCACCTCTGACCGTTTCCGACTACACCGAGACGTGGACGTCGGCGCCTTCTCTGCCACGCCTAGTGCATGAGCCAGTCCGCTGTACCTGCTCTGCACAGGGCACGGGGTTCTCATGCCCCAGCAGTGT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-298-5p(1), mmu-miR-540-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TCCGACTACACCGAGACGTGGACGTC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRCABCA2_214_ORF_1

0.6491

0.254538947

0.245657795

261

ORF sequence:

ATGTTTCTGAGTACCTGCTCTTCACCTCTGACCGTTTCCGACTACACCGAGACGTGGACGTCGGCGCCTTCTCTGCCACGCCTAGTGCATGAGCCAGTCCGCTGTACCTGCTCTGCACAGGGCACGGGGTTCTCATGCCCCAGCAGTGTGGGTGGACACCCACCCCAGATGAGAGTGGTCACAGGTGACATCCTGACTGACATCACTGGCCACAATGTTTCTGAGTACCTGCTCTTCACCTCTGACCGTTTCCGACTACAC

Peptide sequence:

MFLSTCSSPLTVSDYTETWTSAPSLPRLVHEPVRCTCSAQGTGFSCPSSVGGHPPQMRVVTGDILTDITGHNVSEYLLFTSDRFRLH

IRESfinder result

IRESfinder score

0.500872593

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page