top of page

mmu_circ5031439G07Rik_322

Basic information of circular RNA
PanCircBase ID:

mmu_circ5031439G07Rik_322

mm39_Chr. Position ID:

chr15|84833751|84834975|-

Gene name:

5031439G07Rik

Transcript:

ENSMUST00000047144.13

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

9,8

Exon/intron offsets:

0,1061

Genomic length:

1224

Exon/intron sizes in nt:

1,59,163

Flanking exon/introns:

chr15:84833479-84833751|chr15:84834975-84837330

Splice length:

322

Other database IDs:

circAtlas: mmu-5031439G07Rik_0001

circAtlas: hsa-KIAA0930_0001

Human Ortholog IDs:
Mature spliced Sequence:

GTGACCTCCTTTAGCACCCCGCCCACCCCAGAGCGAAACAACCGGCCTGCCTTCTTCTCCCCGTCCCTTAAGAGGAAGGTGCCACGGAACCGCATCGCCGAGATGAAGAAATCACACTCAGCCAACGACAGCGAGGAGTTCTTCCGAGAGGACGACAGTGGAGCCGACCTGCACAATGCCACCAACCTGCGATCTCGGTCCCTGTCTGGCACAGGACGGTCCCTGGTCGGGTCCTGGCTGAAGCTAAACCGAGCTGATGGGAACTTCCTTCTCTATGCACACCTGACCTATGTCACTTTGCCGCTGCATCGGATCTTAACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CCTGGCTGAAGCTAAACCGA

60.04

CCTCTTAAGGGACGGGGAGA

60.03

165

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CCTGGCTGAAGCTAAACCGA

60.04

TCCTCTTAAGGGACGGGGAG

60.03

166

PCR template sequence:

CTGGTCGGGTCCTGGCTGAAGCTAAACCGAGCTGATGGGAACTTCCTTCTCTATGCACACCTGACCTATGTCACTTTGCCGCTGCATCGGATCTTAACAGGTGACCTCCTTTAGCACCCCGCCCACCCCAGAGCGAAACAACCGGCCTGCCTTCTTCTCCCCGTCCCTTAAGAGGAAGGTGCCACGGAACCGCATCGCCG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-153-3p(1), mmu-miR-342-5p(1)

siRNAs for circular RNA silencing
Junction sequence

CGGATCTTAACAGGTGACCTCCTTTA

siRNA sets

AAGGAGGTCACCTGTTAAG, TAAAGGAGGTCACCTGTTA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRC5031439G07RIK_322_ORF_1

0.9381

0.421254737

0.474344484

234

ORF sequence:

ATGAAGAAATCACACTCAGCCAACGACAGCGAGGAGTTCTTCCGAGAGGACGACAGTGGAGCCGACCTGCACAATGCCACCAACCTGCGATCTCGGTCCCTGTCTGGCACAGGACGGTCCCTGGTCGGGTCCTGGCTGAAGCTAAACCGAGCTGATGGGAACTTCCTTCTCTATGCACACCTGACCTATGTCACTTTGCCGCTGCATCGGATCTTAACAGGTGACCTCCTTTAG

Peptide sequence:

MKKSHSANDSEEFFREDDSGADLHNATNLRSRSLSGTGRSLVGSWLKLNRADGNFLLYAHLTYVTLPLHRILTGDLL

IRESfinder result

IRESfinder score

0.315746269

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page