top of page

mmu_circ4732471J01Rik_372

Basic information of circular RNA
PanCircBase ID:

mmu_circ4732471J01Rik_372

mm39_Chr. Position ID:

chr7|25116825|25230887|+

Gene name:

4732471J01Rik

Transcript:

ENSMUST00000206300.2

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

3

Exon/intron indexes:

4,5,6

Exon/intron offsets:

0,113666,113890

Genomic length:

114062

Exon/intron sizes in nt:

1,09,91,172

Flanking exon/introns:

chr7:25096401-25116825|chr7:25230887-25265216

Splice length:

372

Other database IDs:

circAtlas: mmu-Ceacam2_0008

Human Ortholog IDs:
Mature spliced Sequence:

GAGGCAGATGTGTAATCAAGGAATGGCATATACTTCGTAAGCCTCGAGGTGCAATGCAGTCAGCGCTCTACGGTTGTGGATGTTCACTGGGGACTGAAATGGTGATTAGATACTGCTACCTGCTGAGAGGCCCTGGAGCTATTTGGGAGACTACACCCTATCCTGCACGTCATCACCTGCAGCTGGTTCCAGACTCCAAGTTCCAAGATGCCTTCCAGGCTAAAACCCGGACATGTGAGCCACTGGCAGGCCCCAACAATTACACGAACCAACGTGGAACCTGGGAAAGGCAGAGGACATTTGGAAGAAGCACTGCTGGTTTGGAGCTCCATGGAAGAAGAAAAGAATTAAAGAAAACCCGTACTGGAGAAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

AGAAGCACTGCTGGTTTGGA

59.82

ACATCCACAACCGTAGAGCG

60.11

150

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGGAAGAAGCACTGCTGGTT

59.82

ACATCCACAACCGTAGAGCG

60.11

154

PCR template sequence:

CGTGGAACCTGGGAAAGGCAGAGGACATTTGGAAGAAGCACTGCTGGTTTGGAGCTCCATGGAAGAAGAAAAGAATTAAAGAAAACCCGTACTGGAGAAGGAGGCAGATGTGTAATCAAGGAATGGCATATACTTCGTAAGCCTCGAGGTGCAATGCAGTCAGCGCTCTACGGTTGTGGATGTTCACTGGGGACTGAAAT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

1

Interacting miRNAs (#binding sites)

mmu-miR-680(1)

siRNAs for circular RNA silencing
Junction sequence

CGTACTGGAGAAGGAGGCAGATGTGT

siRNA sets

CACATCTGCCTCCTTCTCC,ACACATCTGCCTCCTTCTC,ATCTGCCTCCTTCTCCAGT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRC4732471J01RIK_372_ORF_1

0.6105

0.087363448

0.770516804

690

ORF sequence:

ATGCAGTCAGCGCTCTACGGTTGTGGATGTTCACTGGGGACTGAAATGGTGATTAGATACTGCTACCTGCTGAGAGGCCCTGGAGCTATTTGGGAGACTACACCCTATCCTGCACGTCATCACCTGCAGCTGGTTCCAGACTCCAAGTTCCAAGATGCCTTCCAGGCTAAAACCCGGACATGTGAGCCACTGGCAGGCCCCAACAATTACACGAACCAACGTGGAACCTGGGAAAGGCAGAGGACATTTGGAAGAAGCACTGCTGGTTTGGAGCTCCATGGAAGAAGAAAAGAATTAAAGAAAACCCGTACTGGAGAAGGAGGCAGATGTGTAATCAAGGAATGGCATATACTTCGTAAGCCTCGAGGTGCAATGCAGTCAGCGCTCTACGGTTGTGGATGTTCACTGGGGACTGAAATGGTGATTAGATACTGCTACCTGCTGAGAGGCCCTGGAGCTATTTGGGAGACTACACCCTATCCTGCACGTCATCACCTGCAGCTGGTTCCAGACTCCAAGTTCCAAGATGCCTTCCAGGCTAAAACCCGGACATGTGAGCCACTGGCAGGCCCCAACAATTACACGAACCAACGTGGAACCTGGGAAAGGCAGAGGACATTTGGAAGAAGCACTGCTGGTTTGGAGCTCCATGGAAGAAGAAAAGAATTAAAGAAAACCCGTACTGGAGAA

Peptide sequence:

MQSALYGCGCSLGTEMVIRYCYLLRGPGAIWETTPYPARHHLQLVPDSKFQDAFQAKTRTCEPLAGPNNYTNQRGTWERQRTFGRSTAGLELHGRRKELKKTRTGEGGRCVIKEWHILRKPRGAMQSALYGCGCSLGTEMVIRYCYLLRGPGAIWETTPYPARHHLQLVPDSKFQDAFQAKTRTCEPLAGPNNYTNQRGTWERQRTFGRSTAGLELHGRRKELKKTRTGE

IRESfinder result

IRESfinder score

0.287144658

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page