top of page

mmu_circ2610507B11Rik_453

Basic information of circular RNA
PanCircBase ID:

mmu_circ2610507B11Rik_453

mm39_Chr. Position ID:

chr11|78167865|78170030|+

Gene name:

2610507B11Rik

Transcript:

ENSMUST00000010421.7

CircRNA type:

Exonic circular (circ)RNA

Exon/Intron count:

2

Exon/intron indexes:

24,25

Exon/intron offsets:

0,2007

Genomic length:

2165

Exon/intron sizes in nt:

295,158

Flanking exon/introns:

chr11:78166035-78167865|chr11:78170030-78170534

Splice length:

453

Other database IDs:

circAtlas: mmu-2610507B11Rik_0014

Human Ortholog IDs:
Mature spliced Sequence:

GAGCTTTCTGCTCGAGATGGTGATCCTGCCTTTCATACACACCAGCTGTATTTGGTAGATTTACGGATTTCCTGGACAACCACCAATAGGGACATTGCCTTTGGCTTATATGATGGCTACAAAAAAGCAGCTGTACTCAAACGTAATCTCTCTACTGAGGCCCTGAAAGGTTTGAAGATTGATCCTCAGATGTCAGCCAAAAAGCCAAAGCGGGGTATCCCACCTAGTGCCCAAGTCCCACCTCATGTCAGCACTCCCAGCTTCAGTGGACGGCCTGATAAGGGATCATCAGGAGGTGCTTACATGTTGCAGAAGCTGATTGAAGAGACAGACAGATTTGTAGTATTCACAGAAGAGGAATCCGGTATGAGTGACCAATTGTGTGGCATTGCTGCCTGCCAGACAGATGACATATACAACCGAAACTGCCTTATTGAGCTGGTTAACTGCCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GACCAATTGTGTGGCATTGCT

60

TGGTTGTCCAGGAAATCCGT

59.23

163

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACCAATTGTGTGGCATTGCT

58.95

TGGTTGTCCAGGAAATCCGT

59.23

162

PCR template sequence:

AGAGGAATCCGGTATGAGTGACCAATTGTGTGGCATTGCTGCCTGCCAGACAGATGACATATACAACCGAAACTGCCTTATTGAGCTGGTTAACTGCCAGGAGCTTTCTGCTCGAGATGGTGATCCTGCCTTTCATACACACCAGCTGTATTTGGTAGATTTACGGATTTCCTGGACAACCACCAATAGGGACATTGCCT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-9-5p(1), mmu-miR-34a-5p(1), mmu-miR-196a-5p(1), mmu-miR-138-5p(1), mmu-miR-127-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GGTTAACTGCCAGGAGCTTTCTGCTC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIRC2610507B11RIK_453_ORF_1

0.8802

0.2204555

0.920415492

717

ORF sequence:

ATGTCAGCCAAAAAGCCAAAGCGGGGTATCCCACCTAGTGCCCAAGTCCCACCTCATGTCAGCACTCCCAGCTTCAGTGGACGGCCTGATAAGGGATCATCAGGAGGTGCTTACATGTTGCAGAAGCTGATTGAAGAGACAGACAGATTTGTAGTATTCACAGAAGAGGAATCCGGTATGAGTGACCAATTGTGTGGCATTGCTGCCTGCCAGACAGATGACATATACAACCGAAACTGCCTTATTGAGCTGGTTAACTGCCAGGAGCTTTCTGCTCGAGATGGTGATCCTGCCTTTCATACACACCAGCTGTATTTGGTAGATTTACGGATTTCCTGGACAACCACCAATAGGGACATTGCCTTTGGCTTATATGATGGCTACAAAAAAGCAGCTGTACTCAAACGTAATCTCTCTACTGAGGCCCTGAAAGGTTTGAAGATTGATCCTCAGATGTCAGCCAAAAAGCCAAAGCGGGGTATCCCACCTAGTGCCCAAGTCCCACCTCATGTCAGCACTCCCAGCTTCAGTGGACGGCCTGATAAGGGATCATCAGGAGGTGCTTACATGTTGCAGAAGCTGATTGAAGAGACAGACAGATTTGTAGTATTCACAGAAGAGGAATCCGGTATGAGTGACCAATTGTGTGGCATTGCTGCCTGCCAGACAGATGACATATACAACCGAAACTGCCTTATTGAGCTGGTTAACTGCCAG

Peptide sequence:

MSAKKPKRGIPPSAQVPPHVSTPSFSGRPDKGSSGGAYMLQKLIEETDRFVVFTEEESGMSDQLCGIAACQTDDIYNRNCLIELVNCQELSARDGDPAFHTHQLYLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQMSAKKPKRGIPPSAQVPPHVSTPSFSGRPDKGSSGGAYMLQKLIEETDRFVVFTEEESGMSDQLCGIAACQTDDIYNRNCLIELVNCQ

IRESfinder result

IRESfinder score

0.542778727

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page