top of page

mmu_ciLeng8_221

Basic information of circular RNA
PanCircBase ID:

mmu_ciLeng8_221

mm39_Chr. Position ID:

chr7|4146036|4146257|+

Gene name:

Leng8

Transcript:

ENSMUST00000037472.13

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

8

Exon/intron offsets:

0

Genomic length:

221

Exon/intron sizes in nt:

221

Flanking exon/introns:

chr7:4146036-4146417

Splice length:

221

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTCAGTCTGGGTGACACTGTGAAACAGATATGGGCTGGGGACATGGATCTCAAAACTAGCAGGTTCAGAGACAAGTGGTCCCAAAAGCTGACACCTGTATCTCAGGTCCCCATGGGGTGGGCAGGAGGCCAGGAGTGACCAAGGATGGGTTTTGGGAAGTGGGAAGGGATTACTAGGGAGGTATGGGTGGCTTGATGGCTAAGAGCATCCCCTGGACACAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CTAGGGAGGTATGGGTGGCT

60.1

AGGTGTCAGCTTTTGGGACC

60.18

145

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GCCAGGAGTGACCAAGGATG

60.39

CCATGTCCCCAGCCCATATC

59.96

140

PCR template sequence:

CAGGAGGCCAGGAGTGACCAAGGATGGGTTTTGGGAAGTGGGAAGGGATTACTAGGGAGGTATGGGTGGCTTGATGGCTAAGAGCATCCCCTGGACACAGGTCAGTCTGGGTGACACTGTGAAACAGATATGGGCTGGGGACATGGATCTCAAAACTAGCAGGTTCAGAGACAAGTGGTCCCAAAAGCTGACACCTGTAT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

2

Interacting miRNAs (#binding sites)

mmu-miR-128-3p(1), mmu-miR-362-5p(1)

siRNAs for circular RNA silencing
Junction sequence

CCCCTGGACACAGGTCAGTCTGGGTG

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CILENG8_221_ORF_1

0.8549

0.091636102

0.117979726

177

ORF sequence:

ATGGGTGGCTTGATGGCTAAGAGCATCCCCTGGACACAGGTCAGTCTGGGTGACACTGTGAAACAGATATGGGCTGGGGACATGGATCTCAAAACTAGCAGGTTCAGAGACAAGTGGTCCCAAAAGCTGACACCTGTATCTCAGGTCCCCATGGGGTGGGCAGGAGGCCAGGAGTGA

Peptide sequence:

MGGLMAKSIPWTQVSLGDTVKQIWAGDMDLKTSRFRDKWSQKLTPVSQVPMGWAGGQE

IRESfinder result

IRESfinder score

0.452592729

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page