top of page

mmu_ciHip1r_180

Basic information of circular RNA
PanCircBase ID:

mmu_ciHip1r_180

mm39_Chr. Position ID:

chr5|124127796|124127976|+

Gene name:

Hip1r

Transcript:

ENSMUST00000000939.15

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

3

Exon/intron offsets:

0

Genomic length:

180

Exon/intron sizes in nt:

180

Flanking exon/introns:

chr5:124127796-124127999

Splice length:

180

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTGAGTAGTGAGCACAGCCCTTGGTCCCACAGGCTCAGGCAAGCGCCGCCGCCATGCCACCAGCTGACATCATCCACTGTATCCCATGGAAGTGTGCTGCTCTGACATGTGTCTGTCCTCCTGGGCTGGGGGCTGGACACCCTGCCCAGTGCTGGGAGGGACGGCTCAGGTTCTGTGTCC

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGTGCTGCTCTGACATGTGT

59.89

TGGATGATGTCAGCTGGTGG

59.75

164

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CATGTGTCTGTCCTCCTGGG

59.75

TGGATGATGTCAGCTGGTGG

59.75

151

PCR template sequence:

AGTGTGCTGCTCTGACATGTGTCTGTCCTCCTGGGCTGGGGGCTGGACACCCTGCCCAGTGCTGGGAGGGACGGCTCAGGTTCTGTGTCCGTGAGTAGTGAGCACAGCCCTTGGTCCCACAGGCTCAGGCAAGCGCCGCCGCCATGCCACCAGCTGACATCATCCACTGTATCCCATGGA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-16-5p(1), mmu-miR-15a-5p(1), mmu-miR-15b-5p(1)

siRNAs for circular RNA silencing
Junction sequence

AGGTTCTGTGTCCGTGAGTAGTGAGC

siRNA sets

TCACTACTCACGGACACAG, CTACTCACGGACACAGAAC, ACTCACGGACACAGAACCT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIHIP1R_180_ORF_1

0.4998

-0.021483289

0.031196579

135

ORF sequence:

ATGCCACCAGCTGACATCATCCACTGTATCCCATGGAAGTGTGCTGCTCTGACATGTGTCTGTCCTCCTGGGCTGGGGGCTGGACACCCTGCCCAGTGCTGGGAGGGACGGCTCAGGTTCTGTGTCCGTGAGTAG

Peptide sequence:

MPPADIIHCIPWKCAALTCVCPPGLGAGHPAQCWEGRLRFCVRE

IRESfinder result

IRESfinder score

0.272072815

IRES/non IRES

non-IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page