top of page

mmu_ciGm16567_98

Basic information of circular RNA
PanCircBase ID:

mmu_ciGm16567_98

mm39_Chr. Position ID:

chr6|124508311|124508409|+

Gene name:

Gm16567

Transcript:

ENSMUST00000160967.2

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

1

Exon/intron offsets:

0

Genomic length:

98

Exon/intron sizes in nt:

98

Flanking exon/introns:

chr6:124508311-124518356

Splice length:

98

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTGCCTGGTAGGCAGATGGGGGAGACTTTGGGTCCCATTTTCACAGGGTCTTTCAGCTGCACCAGGGCAATGTCATTGTCAAAATTTGTCCGTGTGTT

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GCACCAGGGCAATGTCATTG

60.11

CCCTGTGAAAATGGGACCCA

59.89

88

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GCACCAGGGCAATGTCATTG

60.11

ACCCTGTGAAAATGGGACCC

59.89

89

PCR template sequence:

CTTTCAGCTGCACCAGGGCAATGTCATTGTCAAAATTTGTCCGTGTGTTGTGCCTGGTAGGCAGATGGGGGAGACTTTGGGTCCCATTTTCACAGGGT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

1

Interacting miRNAs (#binding sites)

mmu-miR-10b-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TTGTCCGTGTGTTGTGCCTGGTAGGC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIGM16567_98_ORF_1

0.5554

-0.312761389

0.014851687

180

ORF sequence:

ATGGGGGAGACTTTGGGTCCCATTTTCACAGGGTCTTTCAGCTGCACCAGGGCAATGTCATTGTCAAAATTTGTCCGTGTGTTGTGCCTGGTAGGCAGATGGGGGAGACTTTGGGTCCCATTTTCACAGGGTCTTTCAGCTGCACCAGGGCAATGTCATTGTCAAAATTTGTCCGTGTGT

Peptide sequence:

MGETLGPIFTGSFSCTRAMSLSKFVRVLCLVGRWGRLWVPFSQGLSAAPGQCHCQNLSVC

IRESfinder result

IRESfinder score

0.737312761

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page