top of page

mmu_ciDusp11_674

Basic information of circular RNA
PanCircBase ID:

mmu_ciDusp11_674

mm39_Chr. Position ID:

chr6|85934891|85935565|-

Gene name:

Dusp11

Transcript:

ENSMUST00000032071.13

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

3

Exon/intron offsets:

0

Genomic length:

674

Exon/intron sizes in nt:

674

Flanking exon/introns:

chr6:85930476-85935565

Splice length:

674

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTAAGTGGCCCTCTGACTGAATAAAAAAAAAACCCAAAATTCATAGTAATTTAACAGTTTTCATCCTATGCTGATGCAAAGACTAAACTTCATTCATGGGTAGCAATAACTAACTTTTAAAGAAGAGCAAATAGTTTTCCTAATTTCATGTAGAAATGAGATTGGAGGCCAGGCATGGATGGTAGTTAATGGCTATAATCCCAGATCTTAGGAGTCTAAGACAGGAGGATCACAAACTCAAGGCCACCTTGGACTACATAAGTCTTCAGCAATGCAAAACACATACACACTAGGTTGGCGACATGAATTAAACTATAATATGTAGTAATTATTATTAGTCTCTTTAATCAGCAAAAGTTCTATAACCATTGAACATTAATTCTCCCTTCTCCTATATGCCAGACCCCTAGTAAACCTCTTATCTGCTTTATTACAATGAATTTCCTTGATCTAGGTATCTTACAGAAGTAGCTCAATGTAACATGCATTTAAATTTTAAATTAATTAAAATAGAACTCTGTCATTTCCTTTAACCTCTCCTTACCCCACCTTCACATCCATAGCCTCCTACTCTGTATTATTGTTGCATGTACATGCAAGTAAACAAATGCAGCCTGCTGAGTCCGTGTAGTTCTGCTTGTGTGTGTGGCTTTTTTCAGGCTGACCACTTGACG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CAAATGCAGCCTGCTGAGTC

59.83

GCATCAGCATAGGATGAAAACTGT

59.66

147

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

ACAAATGCAGCCTGCTGAGT

60.54

GCATCAGCATAGGATGAAAACTGT

59.66

148

PCR template sequence:

GTATTATTGTTGCATGTACATGCAAGTAAACAAATGCAGCCTGCTGAGTCCGTGTAGTTCTGCTTGTGTGTGTGGCTTTTTTCAGGCTGACCACTTGACGGTAAGTGGCCCTCTGACTGAATAAAAAAAAAACCCAAAATTCATAGTAATTTAACAGTTTTCATCCTATGCTGATGCAAAGACTAAACTTCATTCATGGG

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-7b-5p(1), mmu-miR-7a-5p(1), mmu-miR-297a-5p(1), mmu-miR-369-3p(1), mmu-miR-574-5p(1)

siRNAs for circular RNA silencing
Junction sequence

TGACCACTTGACGGTAAGTGGCCCTC

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIDUSP11_674_ORF_1

0.5498

-0.159743534

0.016233346

111

ORF sequence:

ATGTACATGCAAGTAAACAAATGCAGCCTGCTGAGTCCGTGTAGTTCTGCTTGTGTGTGTGGCTTTTTTCAGGCTGACCACTTGACGGTAAGTGGCCCTCTGACTGAATAA

Peptide sequence:

MYMQVNKCSLLSPCSSACVCGFFQADHLTVSGPLTE

IRESfinder result

IRESfinder score

0.880573236

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page