top of page

mmu_ciDip2b_1064

Basic information of circular RNA
PanCircBase ID:

mmu_ciDip2b_1064

mm39_Chr. Position ID:

chr15|100071212|100072276|+

Gene name:

Dip2b

Transcript:

ENSMUST00000100203.10

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

17

Exon/intron offsets:

0

Genomic length:

1064

Exon/intron sizes in nt:

1064

Flanking exon/introns:

chr15:100071212-100072307

Splice length:

1064

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTACTGTTTTCGATCAGGGTTCTCTTGATAGTCTGTCACAGCCTGGGTGAGATGTGAGAGAGGACTTAACTGGTTTTCTGCTTTCTAAACCTAAAAGTAAAATTGCTGAGCAGTCAGTCGTCTCAGGTGTCTCGGTAATACCTCTTCTCGACAGAAGTGCACCTAGAATCTGACAGCTAAGTTTAATTATTCTTATCTCATATTTGTGAGGCACTGTATTCTTCAGAACCCTTTGTGTCTTAAATTAGAAATGATCAGCCAATCATACCTCAGATATGACGATCTATACCTAAACCTTTATTAGTACATACTAGCATATTTCTTTCCTCTTTGCTTTTTTCCCTTGTTAAAGAGAATTGTCTGTGTTAGTCTGTGGACACACAGAGCACGGTGAGAGGTGCTCCTGTGAAGGTCAGAAGAGAGGGTTGGCTGTCCTGTTTTGTCCCTGCTGCCTATTCCCCTGAGGTGCGGCTCTCACTGAGGCTTGCATCTTGGCTAGGCTGCAAGCTAACCAGTCCTCGAGACCCCTGGTCCTTGCAGCCTTGTTCTCAGGCTATAGCATTTGGGGGGTTCCCAGCTTGTTTTATGGGCACTGGGACCCACTCTGGTTCTCAGGATTTTGGAGCCCATGCTCCTCATTGCTGAGCATCTCCAGCCCTGCTCTCCCACTTTCCTTTCCTTTCCTTTCCTTTCCTTTTCTTTCCTTTTTTCTTTTCTTGAGGGACAAGAGTCTCACTATGTAGTCCAGGTTGGCCTCAGATTTGCCCTCTGCCTCTGCCTCAGCCTCTCAAGGACTAGATTGCAGCATGAGCCACCATGCCTGGCTTTTTGTTGTTAATTTCTTCGGAATGTACTTCTGTGCTGGTGTGTGTGTGAGGTGTGTGGAGGTCAGAGGACAACCTGGAGGGAGTTGATTTTCTCCTTTTGCCACGTGGGCCTGGGAATGAAACTCAGGTCATCAGGTTTGCATGGCAGTTGTAACTGAGCTGTCTTCTCAGCCTTCCGAGTTTGCTTCTACTCATCTGGTTGTTTATACTTATTCTTGTTTGTATAGATGTGACTTG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGTCTTCTCAGCCTTCCGAG

59.11

TCCTCTCTCACATCTCACCCA

59.64

141

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CTGTCTTCTCAGCCTTCCGA

59.11

TCCTCTCTCACATCTCACCCA

59.64

142

PCR template sequence:

TTGCATGGCAGTTGTAACTGAGCTGTCTTCTCAGCCTTCCGAGTTTGCTTCTACTCATCTGGTTGTTTATACTTATTCTTGTTTGTATAGATGTGACTTGGTACTGTTTTCGATCAGGGTTCTCTTGATAGTCTGTCACAGCCTGGGTGAGATGTGAGAGAGGACTTAACTGGTTTTCTGCTTTCTAAACCTAAAAGTAA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

7

Interacting miRNAs (#binding sites)

mmu-miR-298-5p(1), mmu-miR-709(1), mmu-miR-214-3p(1), mmu-miR-705(1), mmu-miR-342-3p(1), mmu-miR-3065-5p(1), mmu-miR-490-3p(1)

siRNAs for circular RNA silencing
Junction sequence

TAGATGTGACTTGGTACTGTTTTCGA

siRNA sets

AACAGTACCAAGTCACATC, TCGAAAACAGTACCAAGTC, AAACAGTACCAAGTCACAT

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIDIP2B_1064_ORF_3

0.8506

-0.26928647

0.023941262

153

ORF sequence:

ATGGCAGTTGTAACTGAGCTGTCTTCTCAGCCTTCCGAGTTTGCTTCTACTCATCTGGTTGTTTATACTTATTCTTGTTTGTATAGATGTGACTTGGTACTGTTTTCGATCAGGGTTCTCTTGATAGTCTGTCACAGCCTGGGTGAGATGTGA

Peptide sequence:

MAVVTELSSQPSEFASTHLVVYTYSCLYRCDLVLFSIRVLLIVCHSLGEM

IRESfinder result

IRESfinder score

0.856406349

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page