top of page

mmu_ciDctn1_632

Basic information of circular RNA
PanCircBase ID:

mmu_ciDctn1_632

mm39_Chr. Position ID:

chr6|83174930|83175562|+

Gene name:

Dctn1

Transcript:

ENSMUST00000077407.12

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

25

Exon/intron offsets:

0

Genomic length:

632

Exon/intron sizes in nt:

632

Flanking exon/introns:

chr6:83174930-83175563

Splice length:

632

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTATGTGCTCTGCGTCTGAGAAGATGGTCACTGCCATCCTGTCCCCAGGGCTTCTCCTAGCAGAGTCTACTGGCTTCAGAATGCAGTTTCCTTGATTCTTGTGCACAGTCTCTCCCTGCTCTCTCTTTCCTGTCTCTCTCTCCTCTCTTTTTCCTTTCTTTCTTCTGATATTGGGCGTTGAGCTGAGGGCCTCAAGCCTGCAAGGCTTTTTACTTTAAAAAATTTTTTTGTTTTGTTAAAATTGTTTGAGACAGGGTTTCTCTGTGTGGCCCTGGCTGCCCTGGAACTTGCTCTGTAGCCCAGGCCATCCTCAAACTGCTCGCCTCTGCCTCCCTGAGTGCTGGGATCAAGGGTGTGCACCACTATACCTGGCAATTTTATTTATTTTTTAATGTTTTGTTTTGTTTTGTTTTCGAGACAAGGTCTCAGTAAGTTGCCCAGGTGGGCCTTGAACTTGTGATTCTCCTCTCTCAGTCTCTCAGTGGCTGGGGTTCTAGGCCTCTCCACCAGAGCCAGTTCACTCTTTCTCTCTGAAGTGCCCGTGGTATGTGGGTCTAGTACCGACACTTCTGACCATGCAGTTCAGCTGCTCGGGTGGACCTCAGTGTCCTCAGCATCTCTCCCTCTTCACA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

ACCGACACTTCTGACCATGC

60.32

GACTCTGCTAGGAGAAGCCC

59.25

140

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CCCGTGGTATGTGGGTCTAG

59.25

ACTCTGCTAGGAGAAGCCCT

59.66

160

PCR template sequence:

GAAGTGCCCGTGGTATGTGGGTCTAGTACCGACACTTCTGACCATGCAGTTCAGCTGCTCGGGTGGACCTCAGTGTCCTCAGCATCTCTCCCTCTTCACAGTATGTGCTCTGCGTCTGAGAAGATGGTCACTGCCATCCTGTCCCCAGGGCTTCTCCTAGCAGAGTCTACTGGCTTCAGAATGCAGTTTCCTTGATTCTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

8

Interacting miRNAs (#binding sites)

mmu-miR-298-5p(1), mmu-miR-217-5p(1), mmu-miR-709(1), mmu-miR-185-5p(1), mmu-miR-10b-5p(1), mmu-miR-127-5p(1), mmu-miR-483-5p(1), mmu-miR-540-3p(1)

siRNAs for circular RNA silencing
Junction sequence

CTCCCTCTTCACAGTATGTGCTCTGC

siRNA sets

GAGCACATACTGTGAAGAG, AGAGCACATACTGTGAAGA, ACATACTGTGAAGAGGGAG

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIDCTN1_632_ORF_1

0.867

-0.130182014

0.033951184

117

ORF sequence:

ATGCAGTTCAGCTGCTCGGGTGGACCTCAGTGTCCTCAGCATCTCTCCCTCTTCACAGTATGTGCTCTGCGTCTGAGAAGATGGTCACTGCCATCCTGTCCCCAGGGCTTCTCCTAG

Peptide sequence:

MQFSCSGGPQCPQHLSLFTVCALRLRRWSLPSCPQGFS

IRESfinder result

IRESfinder score

0.958585766

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page