top of page

mmu_ciBrd4_619

Basic information of circular RNA
PanCircBase ID:

mmu_ciBrd4_619

mm39_Chr. Position ID:

chr17|32443213|32443832|-

Gene name:

Brd4

Transcript:

ENSMUST00000125899.2

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

5

Exon/intron offsets:

0

Genomic length:

619

Exon/intron sizes in nt:

619

Flanking exon/introns:

chr17:32443196-32443832

Splice length:

619

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTGAGTTTCTTGAAGTTTACTGTGTTTTGTAAAGCCTTAGTTCTCACCACTTAGGTGGAAATTAAAATGTACAGACTAGGCCCTCAGTTTAGAGCTGAACGGGGACAGCATGTTCTGGACATGGTGACAGAGTGGGGATTCATAAGGCAATGTGATAAGGGCTTTGTTCAAACCTCACTGAGCTGCCATTGGGGTACATTAGGGAGCACTGTTGGAACCCTAAAAAATATTCATCACCAGAAAAAATGCTGTGTAATTTGAGTAGTTCTAGTGAATTCATTTGAGTTGTATCTGAAGAAATCCCAAAGTAAAGGAGGGCCTCCCGTTAGGAAATTAAGCTGGTAGGTACATAAGGCACAAGGATGGTTTCTTGGAGCTTAAAACTGAAAGGAGATTCAGGTGGATAGGTCTTCTTAGGAATACCAAATAGCATAACCATTATGGCCCCTGGAGTCCAGATCTTGTTTAGGAATACCTGGTAGCATAAAGATTGTAGCCCCCTGGAGTCCATAAATCATGAAAGGAGCCTGGGTACAATGCTCCATGTATTGGAGCATGGGGGTGGCCCTGGTGTCCCGTCCACAGAGATGGGAAGAAAAGGCCTTCCAGCTCTACCCCA

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

GTGTCCCGTCCACAGAGATG

60.11

TCAGCTCTAAACTGAGGGCC

59.09

147

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

GTGTCCCGTCCACAGAGATG

60.11

CAGCTCTAAACTGAGGGCCT

59.09

146

PCR template sequence:

AAAGGAGCCTGGGTACAATGCTCCATGTATTGGAGCATGGGGGTGGCCCTGGTGTCCCGTCCACAGAGATGGGAAGAAAAGGCCTTCCAGCTCTACCCCAGTGAGTTTCTTGAAGTTTACTGTGTTTTGTAAAGCCTTAGTTCTCACCACTTAGGTGGAAATTAAAATGTACAGACTAGGCCCTCAGTTTAGAGCTGAAC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

5

Interacting miRNAs (#binding sites)

mmu-miR-23b-3p(1), mmu-miR-23a-3p(1), mmu-miR-433-3p(1), mmu-miR-362-5p(1), mmu-miR-3470b(1)

siRNAs for circular RNA silencing
Junction sequence

CAGCTCTACCCCAGTGAGTTTCTTGA

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIBRD4_619_ORF_3

0.8469

-0.002422382

0.061064085

135

ORF sequence:

ATGAAAGGAGCCTGGGTACAATGCTCCATGTATTGGAGCATGGGGGTGGCCCTGGTGTCCCGTCCACAGAGATGGGAAGAAAAGGCCTTCCAGCTCTACCCCAGTGAGTTTCTTGAAGTTTACTGTGTTTTGTAA

Peptide sequence:

MKGAWVQCSMYWSMGVALVSRPQRWEEKAFQLYPSEFLEVYCVL

IRESfinder result

IRESfinder score

0.716017677

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page