top of page

mmu_ciBrd2_411

Basic information of circular RNA
PanCircBase ID:

mmu_ciBrd2_411

mm39_Chr. Position ID:

chr17|34333452|34333863|-

Gene name:

Brd2

Transcript:

ENSMUST00000173032.2

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

1

Exon/intron offsets:

0

Genomic length:

411

Exon/intron sizes in nt:

411

Flanking exon/introns:

chr17:34333151-34333863

Splice length:

411

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTACCCACTGCATGGGGCAGATGGGCTGCTCAGGCAGGGGCTGGAGCCTGGGGACCAATAAAGCAATACCCATGTCTCCTCATGGGAACATGGCAGTTTTTCATTCTGTGTATCTTACAAAGTTGTACAAAGTCACATACTTTGAAGTCCTTGTTTTTTACAGTTAAGGATAAGTGTGGGGTTAGGGAAATGTAATGGGAGAGAGATGGCCTTGGTCACTTAGAAATGTTTTCTTCTAGACATAGATATTTCTTCAAACCTACCCCAAATCTTTGGACTTCAAACTTGAACCCCAGGGCACAGATCCCTAAGGTCATCCCCACTTGTTTCAAGAGAGGGCTGCTTGAGTCGGGTTGGCAGGGAAAGATGAGACTCTGCCTGTGCAGCTTCTCATGCTGCCTCCTTCTGCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

CAAGAGAGGGCTGCTTGAGT

59.68

GCTTTATTGGTCCCCAGGCT

60.03

146

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TCAAGAGAGGGCTGCTTGAG

59.39

GCTTTATTGGTCCCCAGGCT

60.03

147

PCR template sequence:

GGTCATCCCCACTTGTTTCAAGAGAGGGCTGCTTGAGTCGGGTTGGCAGGGAAAGATGAGACTCTGCCTGTGCAGCTTCTCATGCTGCCTCCTTCTGCAGGTACCCACTGCATGGGGCAGATGGGCTGCTCAGGCAGGGGCTGGAGCCTGGGGACCAATAAAGCAATACCCATGTCTCCTCATGGGAACATGGCAGTTTT

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-709(1), mmu-miR-351-5p(1), mmu-miR-484(1)

siRNAs for circular RNA silencing
Junction sequence

CCTCCTTCTGCAGGTACCCACTGCAT

siRNA sets

NA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIBRD2_411_ORF_1

0.6234

-0.244637537

0.086761375

381

ORF sequence:

ATGTTTTCTTCTAGACATAGATATTTCTTCAAACCTACCCCAAATCTTTGGACTTCAAACTTGAACCCCAGGGCACAGATCCCTAAGGTCATCCCCACTTGTTTCAAGAGAGGGCTGCTTGAGTCGGGTTGGCAGGGAAAGATGAGACTCTGCCTGTGCAGCTTCTCATGCTGCCTCCTTCTGCAGGTACCCACTGCATGGGGCAGATGGGCTGCTCAGGCAGGGGCTGGAGCCTGGGGACCAATAAAGCAATACCCATGTCTCCTCATGGGAACATGGCAGTTTTTCATTCTGTGTATCTTACAAAGTTGTACAAAGTCACATACTTTGAAGTCCTTGTTTTTTACAGTTAAGGATAAGTGTGGGGTTAGGGAAATGTAA

Peptide sequence:

MFSSRHRYFFKPTPNLWTSNLNPRAQIPKVIPTCFKRGLLESGWQGKMRLCLCSFSCCLLLQVPTAWGRWAAQAGAGAWGPIKQYPCLLMGTWQFFILCILQSCTKSHTLKSLFFTVKDKCGVREM

IRESfinder result

IRESfinder score

0.761337972

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page