top of page

mmu_ciAsah1_707

Basic information of circular RNA
PanCircBase ID:

mmu_ciAsah1_707

mm39_Chr. Position ID:

chr8|41807156|41807863|-

Gene name:

Asah1

Transcript:

ENSMUST00000034000.15

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

3

Exon/intron offsets:

0

Genomic length:

707

Exon/intron sizes in nt:

707

Flanking exon/introns:

chr8:41807137-41807863

Splice length:

707

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTATGTTATAAATGTTAACTCTTCTTGTTCTGACTTTATGAAATATAATTCTGCTTTTTAAAAACTACTTTCTAAGTTGCATATGGAAGCCCACACCATAATCCAAGCACTTGGGAGGACTGTGGCAGACCAAGTGTTAGGTGCTTAGGGGCCAGCCTGGTCTACATAATGAGTTTCAAAGTACCCTCTGCTATAGTCTCAAAAATACTACTAGGGAAGATAAAAGATGGGTTGTCATTTGAGAGCACTTGAGGACACTCAGGATCATAGGATAGCTCTCAGTCACCTGTAATTCTAGTTCAGTGGAGTTGTTTGGCCTTGTTTGACATGAGGCATGAACATGGTATATATACGTACTACTCATACATATAAAATAAAAATAATCTTCTTTAAAATTACTACTGAAAGTTAAAGGCATATATTTGATTTTCTTCCACTATGTATAGTAATTGATAGAGGAAAACATCATTTCCCTGTAGCTTTTTGTAATTTGGGACATAGAATTGGTCTCTCCTTCCCTTTGTACTATCTTCCTTCATCTGAATGATTGAGAAGCAATGCTACTTTAAAGAGAAAATTGTGTTCATAAATTCATTGAAAATACTTTCAAACTGTGCTATTTTATTACATATTTTGAATAAGTCAGATCTAAATTGTTTTTATGACAGCAATATGAATCTTAAATCGCAGTACTTATGTATTTTTAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TGACAGCAATATGAATCTTAAATCGCA

59.99

GGTGTGGGCTTCCATATGCA

60.4

142

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

TGACAGCAATATGAATCTTAAATCGCA

59.99

TGGTGTGGGCTTCCATATGC

60.4

143

PCR template sequence:

CAAACTGTGCTATTTTATTACATATTTTGAATAAGTCAGATCTAAATTGTTTTTATGACAGCAATATGAATCTTAAATCGCAGTACTTATGTATTTTTAGGTATGTTATAAATGTTAACTCTTCTTGTTCTGACTTTATGAAATATAATTCTGCTTTTTAAAAACTACTTTCTAAGTTGCATATGGAAGCCCACACCATA

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

3

Interacting miRNAs (#binding sites)

mmu-miR-137-3p(1), mmu-miR-125b-5p(1), mmu-miR-1187(1)

siRNAs for circular RNA silencing
Junction sequence

TATGTATTTTTAGGTATGTTATAAAT

siRNA sets

TATAACATACCTAAAAATA,AACATACCTAAAAATACAT,TAACATACCTAAAAATACA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIASAH1_707_ORF_1

0.7589

-0.393341201

0.020848637

225

ORF sequence:

ATGATTGAGAAGCAATGCTACTTTAAAGAGAAAATTGTGTTCATAAATTCATTGAAAATACTTTCAAACTGTGCTATTTTATTACATATTTTGAATAAGTCAGATCTAAATTGTTTTTATGACAGCAATATGAATCTTAAATCGCAGTACTTATGTATTTTTAGGTATGTTATAAATGTTAACTCTTCTTGTTCTGACTTTATGAAATATAATTCTGCTTTTTAA

Peptide sequence:

MIEKQCYFKEKIVFINSLKILSNCAILLHILNKSDLNCFYDSNMNLKSQYLCIFRYVINVNSSCSDFMKYNSAF

IRESfinder result

IRESfinder score

0.904105917

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page