top of page

mmu_ciAcly_803

Basic information of circular RNA
PanCircBase ID:

mmu_ciAcly_803

mm39_Chr. Position ID:

chr11|100405924|100406727|-

Gene name:

Acly

Transcript:

ENSMUST00000107389.8

CircRNA type:

Circular intronic (ci)RNA

Exon/Intron count:

1

Exon/intron indexes:

8

Exon/intron offsets:

0

Genomic length:

803

Exon/intron sizes in nt:

803

Flanking exon/introns:

chr11:100405924-100406727

Splice length:

803

Other database IDs:

Human Ortholog IDs:
Mature spliced Sequence:

GTGACAAGAAGGAGGGGTGCAGGTGGTTGCCAGCCAGGTTACCCACTCAGTTCCATGTGCGGATTGCCGGGGTCCCTCGTTTCTCACCTGTCTGTGGTGCAGGCACAGACTGGACAATGAAAGCAGCCACATCCTGGAGAGCTTCCAGTGTCTCTAGGGCCACCTGCCCTGGGCACAGCATCTTCTGTAATCTCACGTAGTTGAAAGTGACCTCGTTTTATGGTTTTAGTTCTCGTCATTGATGATGTGTGCCTCAGAGAAATGTAACAAACACAAAAGGACACTAGAAAGTAAAAGCTCCTCTCCCGTCCCTCAGAAGGTCAGAGAACACCTTACTCTGTCCTCCTCCGGCATTTTAATATCTAGACAAACATTTGCACCTTTTCAGTTTTTAGAAATATTGGGACCAAGCTTTATGTGCTGTTTTTTCTCTGAAGCTGTGGTGATTGGTCCTAGCTCTCCTGCTGCCCTGGCTGCAGCAGCCTGCTCCGCTGGGACTCTTGCAGCATACTAGTTCTTGTATCTTCTTATATCTCTGGGCTGTGTCAGGCATTGCTCATTGTTCATTTTACCCACGCTGTGTGTCCAGGACCTTGGTGCCCCGAGGCTGGCAAAGTGCTCTGCCTGGGCGAGTCTCAGGGTACATCGACCTTCAACAGAGGCTGGAGTCCGGGTTGAAGGTTATAGGTCTGCAAGGCCAGTCCTGCAGGCTGACGTCCATGCTTGTGGGCGTAATGGGTAACTGTACAGGTCTGACGCTCTTCTGCCCTGACCAAGCACTGAATTCTGTGTCTCTCTGGCAG

Divergent primers for circular RNA PCR

Primer Set-1

Forward primer
Tm
Reverse primer
Tm
Product size

TCCATGCTTGTGGGCGTAAT

60.03

CAGGTGAGAAACGAGGGACC

60.04

177

Primer Set-2

Forward primer
Tm
Reverse primer
Tm
Product size

CATGCTTGTGGGCGTAATGG

59.9

CAGGTGAGAAACGAGGGACC

60.04

175

PCR template sequence:

CTGCAGGCTGACGTCCATGCTTGTGGGCGTAATGGGTAACTGTACAGGTCTGACGCTCTTCTGCCCTGACCAAGCACTGAATTCTGTGTCTCTCTGGCAGGTGACAAGAAGGAGGGGTGCAGGTGGTTGCCAGCCAGGTTACCCACTCAGTTCCATGTGCGGATTGCCGGGGTCCCTCGTTTCTCACCTGTCTGTGGTGC

Note: Users can design additional primers for provided template sequence using Primer3 or NCBI primer-blast.
miRNAs associated with circular RNAs
No of miRNAs

12

Interacting miRNAs (#binding sites)

mmu-miR-16-5p(1), mmu-miR-15a-5p(1), mmu-miR-15b-5p(1), mmu-miR-146a-5p(1), mmu-miR-19a-3p(1), mmu-miR-18a-5p(1), mmu-miR-125b-5p(1), mmu-miR-381-3p(1), mmu-miR-214-3p(1), mmu-miR-125a-5p(1), mmu-miR-490-3p(1), mmu-miR-146b-5p(1)

siRNAs for circular RNA silencing
Junction sequence

GTCTCTCTGGCAGGTGACAAGAAGGA

siRNA sets

TTGTCACCTGCCAGAGAGA, CTTGTCACCTGCCAGAGAG, CTTCTTGTCACCTGCCAGA

Protein-coding potential of circular RNAs

CPAT analysis

CPAT ORF ID
CPAT Fickett
CPAT Hexamer
Coding probabilty
ORF length

CIACLY_803_ORF_3

0.4866

-0.042240272

0.0440933

204

ORF sequence:

ATGCTTGTGGGCGTAATGGGTAACTGTACAGGTCTGACGCTCTTCTGCCCTGACCAAGCACTGAATTCTGTGTCTCTCTGGCAGGTGACAAGAAGGAGGGGTGCAGGTGGTTGCCAGCCAGGTTACCCACTCAGTTCCATGTGCGGATTGCCGGGGTCCCTCGTTTCTCACCTGTCTGTGGTGCAGGCACAGACTGGACAATGA

Peptide sequence:

MLVGVMGNCTGLTLFCPDQALNSVSLWQVTRRRGAGGCQPGYPLSSMCGLPGSLVSHLSVVQAQTGQ

IRESfinder result

IRESfinder score

0.758155734

IRES/non IRES

IRES

riboCIRC information

riboCIRC ID

NA

NA

Evidence
Peptide sequence:

NA

bottom of page